New Corona Variant, that might be very dangerous, spreads in South Africa

Because SARS-CoV-2 has been found in Quebec white tailed deer

But these military virologists leave out the tryptophan (W) that links bat and pig to Ralph Baric’s lab manipulation of the Kunming virus, RsSHC014. We will un-capitalize positions 352 and 354, because those are two of the 35B5 antibody locations (A352, N354). Putting this to graph paper improves the alignments:

SARS-CoV-2/RaTG13 (closest relative bat virus) are idential in these positions.

EVFNATTFASVYaWnRKRISNCVADYSVLYNSTFS

PHEV, Canada (1962) The sequence is shifted so that amino relationships can be seen.

KIVSSPLNWERKiFsNCNFNMGRLMSFIQAD

Daszak-Shi-Baric Kunming bat virus, RaTG13

PSVYAWERKRISNCVAdYsVLYNSTSFSTF
(This virus has W969, whereas Omicron variant has N969)

So, the expression of all four viruses is nearly the same with the phrase, ‘WERKRISNCV’. As already shown, this is the region for both human and pig coronavirus deletions. Baric’s W is between both communist antibodies.
we post the sequence of white-tailed Ohio deer for comparison.

Positions 340-370
KSVPSPLNWERKTFSNCNFNMSSLMSFIQAD
 
Because SARS-CoV-2 has been found in Quebec white tailed deer


we post the sequence of white-tailed Ohio deer for comparison.

Positions 340-370
KSVPSPLNWERKTFSNCNFNMSSLMSFIQAD

Did you see the covid tongue? Read somewhere else of an HIV connection.

 
Did you see the covid tongue? Read somewhere else of an HIV connection.

Looked and did not find the Rhinolophus-Candida connection. Candida is opportunistic in HIV/AIDS and Candida species causes thrush In the mouth. Candida species use a farnesol that is pathogenic to bat white-nose syndrome fungus, Pseudogymnoascus destructans. Pseudogymnoascus is also found in Siberia.
 
I said it way back when COVID arrived, that once it travel's through the human immune system enough, then the human immune system ultimately breaks the virus down over time. That's why we see viruses over time disappear, regardless of how deadly they were. Yes medicines help also, just like we saw in break through drugs like penicillin and other such infection fighting drugs. It's a multi-pronged approach, and eventually the threat goes away. However, we've never had to force anyone to get help when the remedy or therapy has been offered in a decent humble manor, but the democrat's in their struggle to try and defeat Trump, and to do so with any means possible, it is that they couldn't let a good crisis go to waste... So they in most people's opinions, had politicized COVID, and they tried to attack Trump and his supporters with it. They are still at it to this very day it seems, and all because Trump is still living in their head's rent free.
Most deadly viruses do not completely disappears. The epidemic just run the course; that is herd immunity sets in after enough people have been infected and develop a natural immunity. Since vaccines also create immunity they can speed up the process. However, herd immunity rarely completely ends the virus. For example the Spanish Influenza which was caused by the H1N1 virus is still around today and has caused two pandemics over last 60 years.

What is being forced on people today are not treatments but rather preventive measures (masks, social distancing, vaccines, quarantining. etc). Both social and governmental pressure are typically used in epidemics to get people to practice preventive measures. Unlike treatments, the public rarely sees any results from preventive measures so they often ignore them. Pressure to practice preventive measures have been as inoffensive as signs asking people to wash their hands after using the restroom or as aggressive as being shot for breaking quarantine. Vaccine and mask mandates fall somewhere in between.
 
Because SARS-CoV-2 has been found in Quebec white tailed deer


we post the sequence of white-tailed Ohio deer for comparison.

Positions 340-370
KSVPSPLNWERKTFSNCNFNMSSLMSFIQAD
The CDC has found COVID-19 infections in wild animals like big cats, otters, mink, non-human primates, and white-tailed deer. The number of confirmed species with COVID-19 continues to go as the pandemic continues.

Because every virus has evolved to target a particular species, it’s rare for a virus to be able to jump to another species. When this does happen, it’s by chance, and it usually requires a large amount of contact with the virus. Initially, the virus is usually not well-suited to the new host and doesn’t spread easily. Over time, however, it can evolve in the new host to produce variants that are better adapted.

When populations of the two species are large and in close proximity, likelihood of successful species jumps are increased. This is why a number of species jumps have occurred in wet markets in Asia and Africa.
 
As an aside, omicron is an anagram for Moronic. I'm just sayin.
 
Most deadly viruses do not completely disappears. The epidemic just run the course; that is herd immunity sets in after enough people have been infected and develop a natural immunity. Since vaccines also create immunity they can speed up the process. However, herd immunity rarely completely ends the virus. For example the Spanish Influenza which was caused by the H1N1 virus is still around today and has caused two pandemics over last 60 years.

What is being forced on people today are not treatments but rather preventive measures (masks, social distancing, vaccines, quarantining. etc). Both social and governmental pressure are typically used in epidemics to get people to practice preventive measures. Unlike treatments, the public rarely sees any results from preventive measures so they often ignore them. Pressure to practice preventive measures have been as inoffensive as signs asking people to wash their hands after using the restroom or as aggressive as being shot for breaking quarantine. Vaccine and mask mandates fall somewhere in between.
Can't get to herd immunity if people don't get infected and generate natural immunity, and for those who can get the COVID flu shot, otherwise in order to help get them by because their natural immunity has been compromised, then get the shot.
 
Can't get to herd immunity if people don't get infected and generate natural immunity, and for those who can get the COVID flu shot, otherwise in order to help get them by because their natural immunity has been compromised, then get the shot.
There are two ways you get immunity, by vaccination or getting sick, the sicker you get the higher the immunity. I prefer the former to the latter. Herd immunity for the delta variant has been estimated at 90% to 95% of the population. To get there we will need both natural immunity and immunity from vaccines. If we had to depend on just natural immunity the deaths would be in millions.
 
Tomorrow we will show evidence that Omicron reveals a weakening of the virus, along with evidence that Omicron’s insertion (@214) and deletions (@143-145) may be induced by vaccines.
 
Dangerous!
So far, there have been no reported deaths linked to the omicron variant. 6 days ago
 
The misleading by the media and the government on covid has been the most dangerous thing yet
 
Dangerous!
So far, there have been no reported deaths linked to the omicron variant. 6 days ago
The number of cases in the US are too small to expect deaths. Less than 1 in 100 cases of covid result in deaths. However, judging from reports out of Africa, the virus is less deadly than the delta variant but transmission rate is higher. This could be a good thing. If the disease spreads rapidly with a small number of deaths, it would increase natural immunity without high a death rate. This is pure conjecture. There is nothing to support it except some early observations.
 
I have not changed any thing in my way of life, not been vaccinated, not wore a mask, not changed my life in any way than before the covid scare. worked out in close quarters with many subs. It's more a scare tactic used by governments to get you sheep to follow.
 
I have not changed any thing in my way of life, not been vaccinated, not wore a mask, not changed my life in any way than before the covid scare. worked out in close quarters with many subs. It's more a scare tactic used by governments to get you sheep to follow.
794,000 dead and the number growing by about 1,000 a day is not a scare tactic. It's a fact. You may choose to ignore it. That is your right. However, there are going to be more mandates that make life harder for those who choose to reject vaccines and masks. Where I live, you don't get into a restaurant or a bar without proof of vaccination and a mask.
 
794,000 dead and the number growing by about 1,000 a day is not a scare tactic. It's a fact. You may choose to ignore it. That is your right. However, there are going to be more mandates that make life harder for those who choose to reject vaccines and masks. Where I live, you don't get into a restaurant or a bar without proof of vaccination and a mask.
Looks like the one that was about companies having a hundred or more employees won't be coming about
 
Looks like the one that was about companies having a hundred or more employees won't be coming about
Vaccine requirements are going to happen in most of the country if we don't stop this virus. The Omicron variant just might be the key. It effects younger people much more than the delta variant and has a very high transmission rate. This could translate into more vaccinations and more natural immunity. Increasing the amount natural immunity and vaccinations is very likely to stop the virus. We are certainly better off today than a year ago. 120,000 new daily cases vs 250,000 and 1500 new daily deaths vs 3700.
 
Vaccine requirements are going to happen in most of the country if we don't stop this virus. The Omicron variant just might be the key. It effects younger people much more than the delta variant and has a very high transmission rate. This could translate into more vaccinations and more natural immunity. Increasing the amount natural immunity and vaccinations is very likely to stop the virus. We are certainly better off today than a year ago. 120,000 new daily cases vs 250,000 and 1500 new daily deaths vs 3700.
God is displeased with this generation only when he can end this pestilence
 

New Topics

Back
Top Bottom