Explosion In New Heart Conditions Dismissed As "Post Pandemic Stress Disorder"

Yes, the Painted Turtle from Washington state is subgroup C as in the Chinese porpoise:
Neophocaena / Feline Leukemia Virus Subgroup C
 
The Neophocaena Uniprot entry was submitted in Feb 2021.
 
Fau Chi would give his Dual Use tesitmony to the Senate as the sick Tongguan copper miners were shffling into the Kunming hospital, SARS-CoV-2’s closest relative coming from the same mine, on 26 Ap 2012. A study in North Vietnam in 2012 links to avian influenza in Zosterops japonicus, mentioned earlier in the thread:

Jan 2012 Avian Influenza Viruses in Wild Land Birds in Northern Vietnam
(Colorado State U.; Forestry University of Vietnam, Hanoi; Global Health Program, Wildlife Conservation Society, Bronx, New York, etc.
’....a recent HPAI H5N1 isolate from a tree sparrow linked to limited transmission among humans in China....Nine OP and 1 cloacal swab samples collected from 10 Japanese White_Eyes (Zosterops japonicus) were M gene positive; all of these birds were captured in the human-dominated landscape.’

Both Zosterops japonicus and Phocoena harbor porpoises are also infected with poxviruses.
 
Continuing the inflammation trajectory, autopsies in other countries than the USA revealed more evidence. Hashimoto’s will link to sensitivity to cold:

’Incidentally, autopsy reports from other nations are revealing exactly the same sorts of information that CDC, understandably, wants to protect Americans from learning. In September 2021, veteran german pathologists and professors Dr. Arne Burkhardt, who served as director of the Institute of Pathology in Reutlingen for 18 years, and Dr. Walter Lang, chief of a leading lung pathology institute for 35 years, performed autopsies on 10 cadavers of individuals who died following vaccination, finding that five were very likely, and two more probably, related to the jab.

In three cases, they found strong evidence of leathal multi-system inflammation and runaway autoimmunity, including rare autoimmune diseases, like Hashimoto’s, an autoimmune-triggered hypothyroidism; leukoclastic vasculitis, an inflammatory reaction in the capillaries that leads to skin bleeding, and Sjogren’s syndrome, an inflammation of the salivary and lacrimal glands. ”Three autoimmune diseases in a total of ten is a strikingly high rate,” said Professor Lang.

The doctors also found large clusters of endothelial cells detached from the walls of blood vessels, and clumps of red blood cells that cause thrombosis, and giant cells that formed around trapped foreign bodies. Lang said he had not seen anything like these clusters of lymphocytes in hundreds of thousands of pathological studies: “The lymphocytes are running amok in all organs.” Lang faulted government regulators for hindering autopsies on vaccine reaction: “We’re missing out on 90 percent.” ‘
(Kennedy, The Real Anthony Fauci, p. 74)
 
We’ll take a closer look at pufferfish toxin sequences because avian erythroblastosis virus links to this pufferfish and the virus itself may cause a symptom akin to the Burkhardt-Walter autopsies (above) for ‘clumps of red blood cells that cause thrombosis.’ Surprisingly, a protein from the pufferfish links to TMPRSS2, TMPRSS is a co-receptor for SARS-CoV-2. Furthermore, the location on the spike of SARS-CoV-2 that increases risk of breast cancer may link to the assemblage, TMPRSS2-prostate cancer:

V-ets Erythroblastosis Virus / TMPRSS2 / Prostate Cancer
 
Actually, post #25’s claim about saxitoxin is relevant:

1.) TMPRSS links to both SARS-CoV-2 and the Green Spotted Pufferfish, Tetraodon nigroviridis.

2.) Anthrax toxin receptor links to T. nigroviridis, while saxitoxin and tetraodon-binding protein links to the Panther Puffer, Tetraodon pardalis, as will be shown.

These connections also prompt a closer scrutiny of the Huanan Seafood Market.
 
Which is also a link to a proven coronavirus host, American mink:

V-ets Oncogene / American Mink
 
The Sjogren’s of the Lang-Burkhardt autopsies (post #44) link to avian erythroblastosis virus markers in H. sapiens females:

Oct 2020 Sjogren’s / Avian Erythroblastosis Virus
’....Fig. 2 ERG: avian V-ets erythroblastosis virus E26 oncogene homologue.’
 
The Sjogren’s of the Lang-Burkhardt autopsies (post #44) link to avian erythroblastosis virus markers in H. sapiens females:

Oct 2020 Sjogren’s / Avian Erythroblastosis Virus
’....Fig. 2 ERG: avian V-ets erythroblastosis virus E26 oncogene homologue.’

Speak English, thanks.:tongue:
 
Can you believe this?

It's not the poison jab, oh no, it's stress....:rolleyes:

That's the best they are coming with....lies lies lies.... and the sheeple continue to go for the jabs....at this point may be we better leave them to what will happen to them...and say nothing.....

Sad....:confused:

Haha, so dumb. You people...just duh
 
Speak English, thanks.:tongue:
In other words, the oncogene marker is a cancer marker. The German doctors performing the autopsies in post #44 on the dead COVID patients found Sjogren’s syndrome (SS). This syndrome links to the salivary glands and this correlates to vaginal dryness in Sjogren’s syndrome study of post #48.
 
In other words, the oncogene marker is a cancer marker. The German doctors performing the autopsies in post #44 on the dead COVID patients found Sjogren’s syndrome (SS). This syndrome links to the salivary glands and this correlates to vaginal dryness in Sjogren’s syndrome study of post #48.

ah....ok
 
When you want a spectacular lie, instead of just a mundane lie, you go to zero hedge.
 
If you don’t read Kennedy’s book, at least learn about pathogenic priming with dengue vaccine given to children. Fau Chi knew the cover-up would work:

’Dr. Fauci’s first approach was to abort the three-year clinical trials at six months and then vaccinate the controls — a preemption that would prevent detection of long-term injuries, including pathogenic priming. Regulators initially intended the Pfizer vaccine trial to continue for three full years, until May2, 2023. Because the FDA allowed Pfizer to unblind and terminate its study after six months — and to offer the vaccine to individuals in the placebo group — we will never know whether vaccinated individuals in the trial suffered long-term injuries, including pathogenic priming, that cancelled out short-term benefits. Science and experience tell us that many vaccines can cause injuries like cancers, autoimmune diseases, allergies, fertility problems, and neurological illnesses with long-term diagnostic horizons or long incubation periods. A six-month study will hide these harms.

2. Fauci refuse to fix the VAERS system.

3. Fauci’s capacity to enlist social media companies to make disappear the reporting of deaths.

4. Fauci allowed CDC to discourage autopsies following vaccination.

5. Fauci populated FDA and CDC appointments with loyalists to ensure rubber-stamp approvals of the mRNA vaccine.

6. By vaccinating the entire population, Fauci seems to be striving to eliminate the control group, to hide vaccine injuries.
....
The final summary of the Pfizer’s six-month clinical trial data — the documents that Pfizer submitted to the FDA
to win approval — revealed one key data point that should have killed that intervention forever. Far more people died in the vaccine group than in the placebo group during Pfizer’s clinical trials. The fact that FDA nevertheless granted Pfizer full approval, and that the medical community embraced and prescribed this intervention for their patients, is eloquent testimony to the resilience of even the most deadly and inefficacious products, and the breathtaking power of the pharmaceutical industry and its government allies to control the narrative through captive regulators, compliant physicians, and media manipulation, and to overwhelm the fundamental common sense of much of humanity.’
(Kennedy, The Real Anthony Fauci, pp. 76-7)
 
The reader may wish to begin an autopsy file for vaxxed and unvaxxed covid. This reports shows photos of COVID lung and intramyocardial arteriole:
 
15th post
Here is one of Kennedy’s myocardial excerpts, and we finally get to see an actual number linked to the mRNA vaccine:

’Pfizer’s clinical data predicted potentially fatal myocarditis in one in every 318 teens. Post-marketing data confirm astronomically high rates of myocarditis injuries. On 1 Oct 2021, a team of medical researchers and statisticians found that myocarditis rates reported in VAERS were significantly higher in teens than Pfizer had reported in its clinical data.

According to the Vaccine Adverse Event Reporting System, there have been 7,357 cases of myocarditis and pericarditis reported following COVID vaccines, with 5, 602 cases attributed to Pfizer. Some 476 of these reports occurred in children from 12-17 years old.

According to an article in Current Trends in Cardiology, “Within eight weeks of the public offering of COVID-19 products to the 12-15-year-old age group, we found 19 times the expected number of myocarditis cases in the vaccination volunteers over background myocarditis rates for this age group.” But even these alarming numbers may underreport myocarditis injuries. Israeli data and US data presented to CDC’s advisory committee on 23 Jun 2021 similarly found the rate of reported cases of myocarditis in vaccinated teenage boys aged 12-17 is at least twenty-five times greater than expected, and is fifty times greater than the reported rate in vaccinated males over 65.

These astonishing numbers mean myocarditis is far from a “rare” side effect, as Dr. Fauci and Pfizer like to claim. Nor is it harmless. A recent study suggests that myocarditis is associated with a 50 percent mortality within five years. A teen had effectively zero risk of dying from COVID and a substantial risk of death from vaccination.

In October, 2021, Sweden, Denmark, and Finland announced that they will pause the use of Moderna’s COVID vaccine for children under 18 years of age, after increased reports of inflammatory diseases like myocarditis and pericarditis. That same week, Iceland banned Moderna’s jab outright due to heart inflammation risk.

Furthermore, the VAERS data may also be dramatically underreporting myocarditis and other injuries.

Just before I published this book, in late October 2021, FDA made an extraordinary admission in a letter to Pfizer to explain the chronic underreporting of serious but common vaccine-induced injuries and deaths. FDA, at last, admitted that VAERS is worthless for detecting vaccine injuries:

We have determined that an analysis of spontaneous postmarketing adverse events [VAERS reports] reported under section 505(k)(i) of the FDCA [Federal Food, Drug and Cosmetic Act]] will not be sufficient to assess known serious risks of myocarditis and pericarditis and identify an unexpected serious risk of subclinical myocarditis. Furthermore, the pharmacovigilance system that FDA is required to maintain under secction 505(k)(3) of the FDCA is not sufficient to assess these serious risks.

At best, this letter is a shocking acknowledgement that regulators have no way to assess whether their vaccines are killing and injuring more humans than they are helping. In any rational regulatory environment, FDA’s alarming admission would demand an instantaneous cessation of the vaccine rollout.’
(Kennedy, The Real Anthony Fauci, pp. 90-1)
 
The civet study in post #38 shows that captivity and obesity lead to death, and is directly related to lockdowns.
 
If you don’t read Kennedy’s book, at least learn about pathogenic priming with dengue vaccine given to children. Fau Chi knew the cover-up would work:

’Dr. Fauci’s first approach was to abort the three-year clinical trials at six months and then vaccinate the controls — a preemption that would prevent detection of long-term injuries, including pathogenic priming. Regulators initially intended the Pfizer vaccine trial to continue for three full years, until May2, 2023. Because the FDA allowed Pfizer to unblind and terminate its study after six months — and to offer the vaccine to individuals in the placebo group — we will never know whether vaccinated individuals in the trial suffered long-term injuries, including pathogenic priming, that cancelled out short-term benefits. Science and experience tell us that many vaccines can cause injuries like cancers, autoimmune diseases, allergies, fertility problems, and neurological illnesses with long-term diagnostic horizons or long incubation periods. A six-month study will hide these harms.

2. Fauci refuse to fix the VAERS system.

3. Fauci’s capacity to enlist social media companies to make disappear the reporting of deaths.

4. Fauci allowed CDC to discourage autopsies following vaccination.

5. Fauci populated FDA and CDC appointments with loyalists to ensure rubber-stamp approvals of the mRNA vaccine.

6. By vaccinating the entire population, Fauci seems to be striving to eliminate the control group, to hide vaccine injuries.
....
The final summary of the Pfizer’s six-month clinical trial data — the documents that Pfizer submitted to the FDA
to win approval — revealed one key data point that should have killed that intervention forever. Far more people died in the vaccine group than in the placebo group during Pfizer’s clinical trials. The fact that FDA nevertheless granted Pfizer full approval, and that the medical community embraced and prescribed this intervention for their patients, is eloquent testimony to the resilience of even the most deadly and inefficacious products, and the breathtaking power of the pharmaceutical industry and its government allies to control the narrative through captive regulators, compliant physicians, and media manipulation, and to overwhelm the fundamental common sense of much of humanity.’
(Kennedy, The Real Anthony Fauci, pp. 76-7)
Anti-vaxxer nutball's opinions and misrepresentations on any if this are worth less than nothing.
 
The Green-Spotted pufferfish Tetraodon nigroviridis has already been mentioned in the thread, and tetrodotoxin produced by this genus links to myocardial evidence at autopsy:

Forensic Autopsy / Cardiomyocyte Apoptosis / Tetrodotoxin

Neuropilin-1 acts as a host factor for SARS-VoV-2. It recognizes and binds CendR motif RRAR on the SARS-CoV-2 spike which enhancees infection.

Comparison of neuropilin from human, chimp, yak, pufferfish, and the host genus bat as reservoir of SARS-CoV-2’s closest relative, Rhinolophus:

Yak neuropilin
MDMFPLTWIFLALYFSGHEVRGQADQPCGG
Chimp
MDMLPLTWVFLALYFSRHQVRGQPDPPCGG
H. sapiens
MDMFPLTWVFLALYFSRHQVRGQPDPPCGG
Rhinolophus ferrumequinum
MDMFPLTWVFLAVYFSGLEVRGQPDPPCGG

Rhinolophus ferrumequinum neuropilin
LENYNFELVDGVKLKKDKLNTQSTYSEA
Tetraodon nigroviridis
VDGVKLKKDKMNGQTNYSEA
Japanese Takifugu pufferfish
NYNFELVDGVKSKKDKLNVQNSYLEA

The Rhinolophus bat and Japanese pufferfish sequences are remarkably similar. This is a European Rhinolophus. The myocardial stress of the vaccine is akin to pufferfish poisoning, which prompts review of what was for sale at the Huanan Seafood market.
 

New Topics

Back
Top Bottom