Fauci approved Chloroquine in 2005 for coronavirus infection and spread

[buttercup]

It's interesting how the people who are against chloroquine because they claim there's a chance it might not be 100% safe are very same people who have no problem at all with everyone taking a rushed vaccine with harmful ingredients that we for sure don't know what the effects will be... not to mention funded by people who will make billions if not trillions from it.

Are they illogical? Or dishonest? You decide.

Their purpose is power........and winning the election with the NARRATIVE that anything Trump says must be denounced.

THEY ARE INSANE.

I'm not a Trump supporter, but I agree with you that their primary motivation seems to be partisan politics. Putting petty partisanship above truth, above people, above everything. It is truly despicable.

 

[eagle1462010]

It's interesting how the people who are against chloroquine because they claim there's a chance it might not be 100% safe are very same people who have no problem at all with everyone taking a rushed vaccine with harmful ingredients that we for sure don't know what the effects will be... not to mention funded by people who will make billions if not trillions from it.

Are they illogical? Or dishonest? You decide.

Their purpose is power........and winning the election with the NARRATIVE that anything Trump says must be denounced.

THEY ARE INSANE.

I'm not a Trump supporter, but I agree with you that their primary motivation seems to be partisan politics. Putting petty partisanship above truth, above people, above everything. It is truly despicable.

The drug has saved millions...........to say it's dangerous like they do all the time is INSANE.........their HATE knows no bounds..............it is VERY CLEAR.

 

[sparky]

No we don't.......doctors all over the world have been taking it for prevention.......late stage uses when it's too late don't work........but early stages it's helped according to many doctors

which is entirely correct Eagle. HQC is an age old homeopathic prophylactic used by natives up until Dr Otto Warburg's research . President Trump ,having been on ot for quite some time walked outta Walter Reed in 3 days after testing +

~S~

 

[badger2]

At last! We are very pleased to see a dynamic chloroquine thread!

 

[badger2]

Zzzzzzzzzzzzz

 

[eagle1462010]

lol bump

 

[badger2]

It’s worse then nazi book-burning.

’No surprise, pharmaceutical interests launched their multinational preemptive crusade to restrict and discredit HCQ starting way back in January 2020, months before the WHO declared a pandemic and even longer before President Trump’s controversial March 19 endorsement. On 13 Jan, when rumors of Wuhan flu COVID-19 began to circulate, the French government took the bizarre, inexplicable, unprecedented, and highly suspicious step of reassigning HCQ from an over-the-counter to a prescription medicine. Without citing any studies, French health officials quietly changed the status of HCQ to “List II poisonous substance” and banned its over-the-counter sales. This absolutely remarkable coincidence repeated itself a few weeks later when Canadian health officials did the exact same thing, quietly removing the drug from pharmacy shelves.

A physician in Zambia reported to Dr. Harvey Risch that in some villages and cities, organized groups of buyers emptied drugstores of HCQ and then burned the medication in bonfires outside the towns. South Africa destroyed two tons of life-saving hydroxychloroquine in late 2020, supposedly due to violation of an import regulation. The US government in 2021 ordered the destruction of more than a thousand pounds of HCQ because it was improperly imported. “The Feds are insisting that all of it be destroyed, and not be used to save a single life anywhere in the world,” said a lawyer seeking to resist the senseless order.’
(Kennedy, The Real Anthony Fauci, p. 24, Pharma’s War on HCQ)

 

[ClaireH]

They are both Corona viruses........both SARS.......and the study in the Journal is for Corona virus........the N1H study used Malaria pills...............

Novel means a new mutation......of the same dang virus...........They also knew that it was airborne.......in 2003...........and how it spread...........

It has been studied for 17 years.

Indeed, and COVID-19 should’ve been named properly as SARS2 not Covid-19. They coined that name purposefully although they share 80% similarities.

“SARS originated in China's Guangdong province on November 27, 2002. It presented as a respiratory disease caused by the SARS coronavirus (SARS‐CoV). At the end of the epidemic in June, the infection affected 8422 individuals leading to 916 deaths and a case‐fatality ratio of 10.9% across 29 countries.
On the other hand, COVID‐19 began in Wuhan (China), the largest city in Hubei province, in central China in the last week of December 2019. 2, 3, 4”

COVID‐19 and SARS: Differences and similarities

www.ncbi.nlm.nih.gov

Had common sense determined the name it would not have been to add -19 whatsoever and it would’ve been SARS-2.

Edit- other research sources have documented information that the virus started prior to December, several months prior and how have been painstakingly tracing on USMB.

Science | AAAS

www.science.org

 

[badger2]

Indeed, and COVID-19 should’ve been named properly as SARS2 not Covid-19. They coined that name purposefully although they share 80% similarities.

“SARS originated in China's Guangdong province on November 27, 2002. It presented as a respiratory disease caused by the SARS coronavirus (SARS‐CoV). At the end of the epidemic in June, the infection affected 8422 individuals leading to 916 deaths and a case‐fatality ratio of 10.9% across 29 countries.
On the other hand, COVID‐19 began in Wuhan (China), the largest city in Hubei province, in central China in the last week of December 2019. 2, 3, 4”

COVID‐19 and SARS: Differences and similarities

www.ncbi.nlm.nih.gov

Had common sense determined the name it would not have been to add -19 whatsoever and it would’ve been SARS-2.

Edit- other research sources have documented information that the virus started prior to December, several months prior and how have been painstakingly tracing on USMB.

Science | AAAS

www.science.org

Wuhan World Military Games

Indeed, and COVID-19 should’ve been named properly as SARS2 not Covid-19. They coined that name purposefully although they share 80% similarities.

“SARS originated in China's Guangdong province on November 27, 2002. It presented as a respiratory disease caused by the SARS coronavirus (SARS‐CoV). At the end of the epidemic in June, the infection affected 8422 individuals leading to 916 deaths and a case‐fatality ratio of 10.9% across 29 countries.
On the other hand, COVID‐19 began in Wuhan (China), the largest city in Hubei province, in central China in the last week of December 2019. 2, 3, 4”

COVID‐19 and SARS: Differences and similarities

www.ncbi.nlm.nih.gov

Had common sense determined the name it would not have been to add -19 whatsoever and it would’ve been SARS-2.

Edit- other research sources have documented information that the virus started prior to December, several months prior and how have been painstakingly tracing on USMB.

Science | AAAS

www.science.org

World Military Games, Wuhan, China 18-27 Oct 2019 There were 900 participants, and the streets were supposedly deserted as they arrived.

 

[badger2]

Why did they never find the exact source of SARS-CoV in the civets and raccoon dogs? The latter are raised on commercial farms.

 

[badger2]

Daszak collected RsSHC014 in 2011. It went to Ralph Baric. Here, the virus achieves 10,000 times the rate of the original virus:

NIH Documents Provide New Evidence U.S. Funded Gain-of-Function Research in Wuhan

The National Institutes of Health-funded experiment in Wuhan, China, posed biosafety risks but did not cause the Covid-19 pandemic, scientists say.

theintercept.com

‘....10,000 times the rate of original virus....Graph from a report on NIH-funded research in Wuhan showing viral load in lung tissues of humanized mice: SHC014.....Trump suspended funding in Ap 2020....’

 

[ClaireH]

Why did they never find the exact source of SARS-CoV in the civets and raccoon dogs? The latter are raised on commercial farms.

Good question.

"Severe acute respiratory syndrome-related coronaviruses were found in raccoon dogs during the SARS outbreak, which was facilitated by animal-to-human contact in live-animal markets in China."

"A study published in June1 found that live animals susceptible to SARS-CoV-2, such as raccoon dogs and mink, were sold in numerous markets in Wuhan. Previous studies2 of the virus that caused severe acute respiratory syndrome (SARS) have concluded that it, too, probably jumped multiple times from animals to people."

Did the coronavirus jump from animals to people twice?

A preliminary analysis of viral genomes suggests the COVID-19 pandemic might have multiple animal origins — but the findings still have to be peer reviewed.

www.nature.com

"Some of these farmed species (American minks, red foxes, and raccoon dogs) were sold alive for food by Wuhan animal sellers, as was trapped wildlife (including raccoon dogs and badgers), although no bat species were for sale (10). Together, this suggests a central role for SARSr-CoV–susceptible live intermediate host animals as the primary source of the SARS-CoV-2 progenitor that humans were exposed to, as was the case with the origin of SARS."

Science | AAAS

www.science.org

 

[badger2]

Good question.

"Severe acute respiratory syndrome-related coronaviruses were found in raccoon dogs during the SARS outbreak, which was facilitated by animal-to-human contact in live-animal markets in China."

"A study published in June1 found that live animals susceptible to SARS-CoV-2, such as raccoon dogs and mink, were sold in numerous markets in Wuhan. Previous studies2 of the virus that caused severe acute respiratory syndrome (SARS) have concluded that it, too, probably jumped multiple times from animals to people."

Did the coronavirus jump from animals to people twice?

A preliminary analysis of viral genomes suggests the COVID-19 pandemic might have multiple animal origins — but the findings still have to be peer reviewed.

www.nature.com

"Some of these farmed species (American minks, red foxes, and raccoon dogs) were sold alive for food by Wuhan animal sellers, as was trapped wildlife (including raccoon dogs and badgers), although no bat species were for sale (10). Together, this suggests a central role for SARSr-CoV–susceptible live intermediate host animals as the primary source of the SARS-CoV-2 progenitor that humans were exposed to, as was the case with the origin of SARS."

Science | AAAS

www.science.org

Well then, the next question might be, “Since the marketers who brought their animals to Wuhan were known, why did they fail to show their responsiblity to the rest of the world by tracing the origins of the animals back to farm or jungle?

 

[badger2]

The origins article is very good. Did not know about Yn06 and Yn 02, both occurring toward Mengla, where the Mengla filovirus from a fruit bat came from, linking Marburg and ebola.

 

[badger2]

Good question.

"Severe acute respiratory syndrome-related coronaviruses were found in raccoon dogs during the SARS outbreak, which was facilitated by animal-to-human contact in live-animal markets in China."

"A study published in June1 found that live animals susceptible to SARS-CoV-2, such as raccoon dogs and mink, were sold in numerous markets in Wuhan. Previous studies2 of the virus that caused severe acute respiratory syndrome (SARS) have concluded that it, too, probably jumped multiple times from animals to people."

Did the coronavirus jump from animals to people twice?

A preliminary analysis of viral genomes suggests the COVID-19 pandemic might have multiple animal origins — but the findings still have to be peer reviewed.

www.nature.com

"Some of these farmed species (American minks, red foxes, and raccoon dogs) were sold alive for food by Wuhan animal sellers, as was trapped wildlife (including raccoon dogs and badgers), although no bat species were for sale (10). Together, this suggests a central role for SARSr-CoV–susceptible live intermediate host animals as the primary source of the SARS-CoV-2 progenitor that humans were exposed to, as was the case with the origin of SARS."

Science | AAAS

www.science.org

Fau Chi would have been aware that during his testimony to the Senate in 2012 as the sick copper miners went into the hospital, or shortly after, that this Science report map shows the closest physical presence to Wuhan is the Longquan 140 virus of 2012. Verifying the date of collection and the actual spike sequence will compare with other sequences such as Omicron. It came from Rhinolophus monoceros.

 

[badger2]

The closest to Wuhan, Longquan 140 virus links to Beijing CDC’s golden boy virologist, Yong-zhen Zhang, automatically linking the Australian, EC Holmes, mentioned by Edward Hooper on his Origins page. So, the Science report in post #52 for animal origins of SARS-CoV-2, stating that focusing on Yunnan is faulty, is itself faulty and not well informed about Zhang, who attended the Kunming Institute of Zoology, Yunnan, China. Here is the sequence of Longquan 140:

Uniprot / Longquan 140 Spike

UniProt

www.uniprot.org

 

[badger2]

UniProt

www.uniprot.org

 

[badger2]

We see that an Omicron clue for SARS-CoV-2 happens with the Longquan virus at position 214 of the spike:

Omicron insertion @ position 214 is EPE, which is the first insertion to occur on the spike of any variant. When we compare Zhang’s Longquan 140, we note that the bat virus indeed sports a glutamic acid @ 214 (E214). Position 215 is a proline (P). SARS-CoV-2 Omicron, apparently having evolved in South Africa, may think it‘s still inside the rump of a bat in Longquan.

 

[badger2]

The Science report, above, is most definitely misleading, as will be shown when comparing Zhang’s Longquan 140 collected nearest to Wuhan. Longquan 140 has identical sequences to the virus Daszak collected in 2011 at Kunming, the virus that then went to Barric’s North Carolina lab, RsSHC014.

 

[badger2]

This sequence comparison is best when transcribed to graph paper whereby the sequence continues onto the next page.

SARS-CoV-2 Spike Positions 710 -840 (= RaTG13)
NSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC

Longquan 140 (Hubei Province, 2012) Spike Positions 710-840
YICGDSLECSNLLLQYGSFCTQLNRALTGIAIEQDKNTQEVFAQVKQMYKTPAIKDFGGFNFSQILPDPSKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDVSARDLICAQKFNGLTVLPPLLTDEMIA

RsSHC014 (Kunming, Yunnan Province, 18 Ap 2011) Spike Positions 710-840
MPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALSGIAVEQDRNTREVFAQVKQMYKTPTLKDFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNG

This proves identical sequences over space and time as well as different Rhinolophus bat species, R. affinis (RaTG13), R. monoceros (Longquan 140), and R. sinicus (Kunming)..